PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 896916
Common NameARALYDRAFT_896916
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family FAR1
Protein Properties Length: 224aa    MW: 25848.8 Da    PI: 9.0921
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
896916genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR193.62.4e-2953142191
    FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
             +fY++YA  +GF +r+++ ++s r+g++++r++vC+keg+r+++ ++ +++r++ra tr gCka ++vk+ek+gkw+vtkle+eHnH+l p
  896916  53 SFYDNYAICMGFVMRVDAFRRSMRDGTVVWRRLVCNKEGFRRSRPRR-SESRKPRAITREGCKALIVVKREKSGKWVVTKLEKEHNHPLLP 142
             5********************************************99.9***************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.2E-2753142IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MFMCCVATVE GNSLPEEDVE MMENSDGMKT VESFPMVEPF IGMKFESEEA AKSFYDNYAI  60
CMGFVMRVDA FRRSMRDGTV VWRRLVCNKE GFRRSRPRRS ESRKPRAITR EGCKALIVVK  120
REKSGKWVVT KLEKEHNHPL LPLSPNVRRN PPLPQTPDEK DAKIRELSAE LSRERRRCTA  180
LQQQLDMVLK EMEEHSNHLS VNINNVIQSV RQIESNTFTK PLS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0040310.0BT004031.1 Arabidopsis thaliana clone RAFL15-31-E07 (R20864) unknown protein (At3g07500) mRNA, complete cds.
GenBankBT0050830.0BT005083.1 Arabidopsis thaliana clone U20864 unknown protein (At3g07500) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882533.11e-166far-red impaired responsive family protein
TrEMBLD7L6L31e-165D7L6L3_ARALL; Far-red impaired responsive family protein
STRINGscaffold_300886.11e-165(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135242227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.11e-122FAR1 family protein